PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29693.m002060
Common NameLOC8284011, RCOM_0634190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 310aa    MW: 34439.1 Da    PI: 7.4964
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29693.m002060genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.82.5e-34166223259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  29693.m002060 166 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSFQDPSIVITTYEGQHNHP 223
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381305.7E-962310IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.3E-36150225IPR003657WRKY domain
SuperFamilySSF1182904.18E-30157225IPR003657WRKY domain
PROSITE profilePS5081132.765160225IPR003657WRKY domain
SMARTSM007744.1E-40165224IPR003657WRKY domain
PfamPF031061.0E-26166223IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSDDHSRDLY YHAPFHEDHQ FILGSSTNYG SSQGLDPSSF LSFTECLHGS MDYNSLSKAF  60
GMSPSSSEVI SSMEGNPKPL EIGDLGSGGG NSENPVTPNS SASFSSSEAG GEEDSGKTAT  120
KKGNQPKGSE DGECSKKDGK TKKKGEKRQR EPRFAFMTKS EVDHLEDGYR WRKYGQKAVK  180
NSPYPRSYYR CTTQKCTVKK RVERSFQDPS IVITTYEGQH NHPIPATLRG NAAAMFSHSM  240
LTPANPMVTR PTFPQEILVQ LPHLSNQAGT GSIYQQSVNH QHHLHQYHHQ VPDYGLLQDI  300
VPSMFFKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-30155226778Probable WRKY transcription factor 4
2lex_A8e-30155226778Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519733.10.0PREDICTED: probable WRKY transcription factor 28
SwissprotQ8VWJ21e-83WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLB9S1640.0B9S164_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0001s34520.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.14e-64WRKY DNA-binding protein 28